Cluster: cluster_11211

CRISPR-Cas subtypes that co-occur with the candidate CAS-II-A: 4, CAS-I-B: 1, CAS-I-C: 2, CAS-III-B: 1, CAS-I-E: 4
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 22.22
Mean length of the directons containing the candidates 3.4444444444444446
Percent of cluster members that occur in self-targeting genomes 11.11
Number of members in the cluster 9
Model score for cluster 0.61
Consensus sequence MPIQNAWVFTETKFNDDEFLNNTNNMFRLVSQRPYASKKDPDEKGVTLTLQITKDNTDYG
VDKKTGMKRDNNVLNTFDVTILNNKEHIDVKKGDYVRLGDFIEEKSFIIGFDLILRYKDV
EKINVQTK
Accessions (where available) / Location EDT48291.1
EEI59071.1
LN831779.1:52429-52815:+
EEV60291.1
KRK36686.1
KRM43482.1
BAXP01000022.1:57096-57449:-
BBBR01000016.1:9738-10001:-
KOY73701.1