Cluster: cluster_11279

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-F: 6, CAS-IV-A: 5, CAS-I-E: 1
Percentage of cluster members that co-occur with known Acrs 44.44
Percentage of cluster members that are adjacent to an HTH protein 22.22
Mean length of the directons containing the candidates 4.555555555555554
Percent of cluster members that occur in self-targeting genomes 88.89
Number of members in the cluster 9
Model score for cluster 0.3
Consensus sequence VGEPAAIYLLVLKVICFGCAGLFILLFILGLLEAFVYKLEKQRDPPSAQAVKNDVGSGGE
DGSISAWCINIEAE
Accessions (where available) / Location KSQ35875.1
JTVI01000073.1:26228-26452:+
JTMB01000013.1:22365-22589:+
JTOK01000020.1:5193-5417:-
CUXV01000089.1:16939-17163:+
JTQJ01000026.1:46920-47126:+
JTPQ01000026.1:46920-47126:+
JTSO01000055.1:102739-102927:-
JVCP01000096.1:28818-29006:-