Cluster: cluster_11400

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-B: 4, CAS-I-E: 6, CAS-I-E, CAS-I-E: 1
Percentage of cluster members that co-occur with known Acrs 11.11
Percentage of cluster members that are adjacent to an HTH protein 22.22
Mean length of the directons containing the candidates 2.7777777777777786
Percent of cluster members that occur in self-targeting genomes 11.11
Number of members in the cluster 9
Model score for cluster 0.36
Consensus sequence MQTQTAQTTAQAAPQQGSHHYVLTLQLPHGGGFMMATWDGTCTPATGMTRADIYQWLRSE
IVRQHPELARANVVFFSLEPNQL
Accessions (where available) / Location JAIZ01000276.1:14913-15170:+
AEM80601.1
AGP56725.1
JAIY01000022.1:29745-29999:-
AXVU01000015.1:34239-34481:+
CM001015.1:4907001-4907237:+
EFG09308.1
KL570018.1:32152-32373:-
LAVK01000030.1:5818-6060:+