| CRISPR-Cas subtypes that co-occur with the candidate | CAS-II-C: 5, CAS-VI-B: 8 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 0.0 |
| Percentage of cluster members that are adjacent to an HTH protein | 100.0 |
| Mean length of the directons containing the candidates | 2.7777777777777786 |
| Percent of cluster members that occur in self-targeting genomes | 42.86 |
| Number of members in the cluster | 9 |
| Model score for cluster | 0.79 |
| Consensus sequence | MLNHQTTAPTANNSSEVQNQKTIDRAKRLSEFNSCFGVDQDNLFYLVTEQMDMLTGEIRK GYYQNAEQRVANLASLLWAMHNRLPKDFFEDVELLTDDILLNTKSA |
| Accessions (where available) / Location |
AFD55170.1 ADQ83108.1 ADQ83081.1 AKP70259.1 AKQ40720.1 EFT36341.1 AFD55143.1 ADZ11380.1 YP_007003641.1 |