Cluster: cluster_11848

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-E: 7, CAS-II-C: 4
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 100.0
Mean length of the directons containing the candidates 4.555555555555554
Percent of cluster members that occur in self-targeting genomes 25.0
Number of members in the cluster 9
Model score for cluster 0.26
Consensus sequence MAHTTGENLFTMKRVLRNLEADHDALREALADGRRMRDLLPYGDYINRYRNLTRDPMVVA
IHKQFHESGLGGLTIDESMFPLSLRFEDDDVTLVFRRPEGFRHGTNEESSQRQLIERRSR
IVLFWKYAEPGTDALKRISLQMFDNEGPLEEATMLSEKIPLLTKPESLTTAMFIPTHADE
PRFVFGS
Accessions (where available) / Location AEG82893.1
AEX71145.1
EIK57160.1
CAE48688.1
AEX66343.1
KKA82052.1
AEX68861.1
AEX68822.1
AJGI01000019.1:31436-31999:+