| CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-A: 1, CAS-I-C: 2, CAS-I-E: 7, CAS-I-C, CAS-III-B: 2, CAS-III-A: 6, CAS-III-B, CAS-I-C: 3, CAS-I-B: 1, CAS-III-B: 2 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 0.0 |
| Percentage of cluster members that are adjacent to an HTH protein | 12.5 |
| Mean length of the directons containing the candidates | 3.625 |
| Percent of cluster members that occur in self-targeting genomes | 37.5 |
| Number of members in the cluster | 8 |
| Model score for cluster | 0.51 |
| Consensus sequence | MNVSEIIWKSVGRGAAHPSEVLNALIELDNRKGQIGLWALENELRAKMPLLRPAARPLAQ AWLEATVLYRTTFYPEGRLSRLFHRFVQPEQRPLPFAS |
| Accessions (where available) / Location |
KE387023.1:566784-567083:+ JHVI01000004.1:93696-93992:+ AGK05494.1 AXWR01000043.1:11786-12082:- GAO75976.1 JRGA01000001.1:1991603-1991899:+ ADD29055.1 AEB11474.1 |