| CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-C: 8 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 0.0 |
| Percentage of cluster members that are adjacent to an HTH protein | 12.5 |
| Mean length of the directons containing the candidates | 1.75 |
| Percent of cluster members that occur in self-targeting genomes | 12.5 |
| Number of members in the cluster | 8 |
| Model score for cluster | 0.24 |
| Consensus sequence | MRNDRKKTVAMYIRFGRAESSNHSSCKRDSIDWKQMWEDYRKEQKKYPLSKVRL |
| Accessions (where available) / Location |
ENZ53168.1 ENZ48322.1 KMW22571.1 EDP17518.1 ENZ41595.1 ENZ62524.1 KJJ74836.1 ENZ43254.1 |