CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-A: 2, CAS-I-C: 5, CAS-V-B: 3, CAS-I-B: 3 |
---|---|
Percentage of cluster members that co-occur with known Acrs | 0.0 |
Percentage of cluster members that are adjacent to an HTH protein | 12.5 |
Mean length of the directons containing the candidates | 2.125 |
Percent of cluster members that occur in self-targeting genomes | 25.0 |
Number of members in the cluster | 8 |
Model score for cluster | 0.21 |
Consensus sequence | MGPTRLRYTMIGFIAGVLVVYLKDLPMGEGVRFAAPFYGAGIGLLIDGIILRMKQRKGKE E |
Accessions (where available) / Location |
EJL47348.1 EST54010.1 JXAV01000042.1:10896-11081:- EMT50466.1 JAQG01000087.1:46073-46258:- KI301976.1:224958-225143:+ JATL01000041.1:113797-113982:+ ELK43483.1 |