Cluster: cluster_12805

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-B: 6, CAS-II-A: 4
Percentage of cluster members that co-occur with known Acrs 87.5
Percentage of cluster members that are adjacent to an HTH protein 75.0
Mean length of the directons containing the candidates 2.75
Percent of cluster members that occur in self-targeting genomes 87.5
Number of members in the cluster 8
Model score for cluster 0.82
Consensus sequence MMNLKTIFEKWGYGHLKEEIEDLEDGYEVVINVVDRDTFNLMNDLNESTKFTVYEDCIND
TITIAHC
Accessions (where available) / Location CAR82815.1
YP_001468739.1
AEH91122.1
ACK40883.1
CAC96529.1
AGR15526.1
KHK10891.1
EFK40544.1