| CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-E: 5, CAS-I-F: 3 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 0.0 |
| Percentage of cluster members that are adjacent to an HTH protein | 100.0 |
| Mean length of the directons containing the candidates | 3.125 |
| Percent of cluster members that occur in self-targeting genomes | 12.5 |
| Number of members in the cluster | 8 |
| Model score for cluster | 0.59 |
| Consensus sequence | MTEKISSIKPRQVRFTEKVDSHIRESAKRCHRSIQAEIAYRMELLMKLEAKGDVVIQ |
| Accessions (where available) / Location |
AIBM01000063.1:16259-16432:+ BBVP01000013.1:123979-124152:- EQQ12403.1 JSRE01000057.1:425428-425601:- JSRD01000037.1:359778-359951:- EQR11157.1 JSHQ01000044.1:318587-318760:+ EQR03088.1 |