| CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-E: 6, CAS-II-C: 4, CAS-III-A: 5, CAS-I-C: 2 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 0.0 |
| Percentage of cluster members that are adjacent to an HTH protein | 12.5 |
| Mean length of the directons containing the candidates | 4.625 |
| Percent of cluster members that occur in self-targeting genomes | 20.0 |
| Number of members in the cluster | 8 |
| Model score for cluster | 0.2 |
| Consensus sequence | MYLHLGQDYVLNDRDVIGIFDLDTATVSPRTREFLNHAQKEGAVVDLSDELPQSFVLCDG APDETVYLSQLSPAALRRRAEKMEE |
| Accessions (where available) / Location |
ADJS01009807:4112-4426:- ADJS01013303:4216-4476:- CDC31223.1 ADJS01012749:3606-3863:+ ADJS01014382:714-971:- EDP21448.1 LN868535.1:472906-473151:- JNJN01000012.1:16615-16875:- |