Cluster: cluster_1360

CRISPR-Cas subtypes that co-occur with the candidate	CAS-II-A: 71, CAS-I-C: 4, CAS-II-C: 2
Percentage of cluster members that co-occur with known Acrs	0.0
Percentage of cluster members that are adjacent to an HTH protein	1.35
Mean length of the directons containing the candidates	2.310810810810811
Percent of cluster members that occur in self-targeting genomes	48.65
Number of members in the cluster	74
Model score for cluster	0.32
Consensus sequence	MEHYLTEGGVLYFVVYSKDVSPTVTYASLTPKVIKNVLPASDKKKRIKKKEDIFLLFWMA IIAKLLILPYPALQTSYKSRPCLRRSSLRKLTQIPFSIVTKVGNTNMKSITAFLQVKAYI LPCLAKGPARIMV
Accessions (where available) / Location	CECS01000003.1:5255-5740:- AUIO01000002.1:16225-16710:+ CEGZ01000043.1:22462-22947:+ CEEN01000020.1:5373-5858:- CEHN01000027.1:71339-71824:+ KLJ37313.1 EPU73762.1 EPT62027.1 EPW90050.1 EPX33155.1 EAO63137.1 EPW12108.1 EPX44372.1 EPW55946.1 EPV61874.1 EPU95717.1 EPV13239.1 EPV80538.1 EPV51621.1 EPV10023.1 KXA43599.1 EPT88465.1 EPT59616.1 EPV22770.1 EPW99491.1 EPU90913.1 EPT66306.1 EPW69804.1 EPT55684.1 EPT56210.1 EPX40276.1 EPT63770.1 EPV46569.1 KLD93052.1 AKU03765.1 KLL14758.1 KLK31893.1 EPW02691.1 KLL66053.1 EPT66849.1 KLK36083.1 KLJ37794.1 KLJ19100.1 EPT49609.1 EPW41282.1 KLK73480.1 KLJ63526.1 KLJ27316.1 KLJ99604.1 EPW30309.1 EPW61051.1 EPU44914.1 KLJ97692.1 KLJ20424.1 KLK54605.1 KLK06760.1 KLJ84680.1 KLL80680.1 KLK40269.1 EPV69411.1 KLL83335.1 EPV28758.1 KLJ22993.1 EPT52053.1 KLJ66425.1 KLJ89879.1 KLL37556.1 EPT96790.1 KLJ65536.1 EPU04291.1 KLJ70936.1 EPV04125.1 KLL63121.1 EPT44803.1