| CRISPR-Cas subtypes that co-occur with the candidate | CAS-II-A: 2, CAS-VI-C: 1, CAS-I-B: 4, CAS-III-A: 2 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 0.0 |
| Percentage of cluster members that are adjacent to an HTH protein | 14.29 |
| Mean length of the directons containing the candidates | 3.8571428571428568 |
| Percent of cluster members that occur in self-targeting genomes | 42.86 |
| Number of members in the cluster | 7 |
| Model score for cluster | 0.45 |
| Consensus sequence | MKQFPHLKHVVLGELKTKSGKNLFRKLNEHSKELQAKQEEIAKKHNSLSAQYEELEHLKN NMNEYLGRDKREKKESVIGKIKKHKEEEKERSKEKKEKSKEVER |
| Accessions (where available) / Location |
EHO18272.1 EGS34059.1 EHL16078.1 EHL18661.1 ALA96460.1 EQH44671.1 EIC96959.1 |