| CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-C: 4, CAS-IV-A: 1, CAS-I-F: 2, CAS-III-A: 2 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 14.29 |
| Percentage of cluster members that are adjacent to an HTH protein | 14.29 |
| Mean length of the directons containing the candidates | 3.714285714285714 |
| Percent of cluster members that occur in self-targeting genomes | 42.86 |
| Number of members in the cluster | 7 |
| Model score for cluster | 0.51 |
| Consensus sequence | KVSIKQVREKLRCKFGARRYRIRKDGYVHVWGIMPNTNGYGWYLFAWVDELIKHFESML |
| Accessions (where available) / Location |
KQY83735.1 EMO53920.1 AEC16386.1 KGQ61159.1 KGQ32717.1 KGQ66118.1 KGQ36392.1 |