Cluster: cluster_15341

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-F: 5, CAS-I-E: 3, CAS-I-E, CAS-I-F: 1
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 28.57
Mean length of the directons containing the candidates 2.2857142857142865
Percent of cluster members that occur in self-targeting genomes 14.29
Number of members in the cluster 7
Model score for cluster 0.49
Consensus sequence MNNYNNATMYVDKFTGKQYLVQNGYSGRVQQYAAGVPVWFDGSCCAGGKLGVTDFKTRAN
LNSWLRMMGFKK
Accessions (where available) / Location CAF25478.1
KER01094.1
CAE15300.1
ADP12329.1
CAX55525.1
AYMN01000119.1:2397-2600:-
AYMQ01000052.1:54672-54875:+