| CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-E: 3, CAS-I-U: 7, CAS-I-C: 3 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 0.0 |
| Percentage of cluster members that are adjacent to an HTH protein | 14.29 |
| Mean length of the directons containing the candidates | 2.2857142857142865 |
| Percent of cluster members that occur in self-targeting genomes | 14.29 |
| Number of members in the cluster | 7 |
| Model score for cluster | 0.21 |
| Consensus sequence | LGTPLRATIAPATHGGYLLLIHYTQGTEWVSTLPTRTTPGRHDEREFAAVADALTARGLT RTSPWQIDSDARLCTDITTVRRTTGKEDRRG |
| Accessions (where available) / Location |
KB896530.1:429636-429992:+ KB900388.1:4016494-4016835:- AZWJ01000005.1:80627-80968:+ AZWU01000051.1:16844-17122:+ AZXI01000064.1:7390-7662:+ AZWF01000009.1:56725-56988:+ KB896706.1:56719-56982:+ |