CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-C: 5, CAS-I-B: 2, CAS-III-B: 1, CAS-III-D: 1 |
---|---|
Percentage of cluster members that co-occur with known Acrs | 0.0 |
Percentage of cluster members that are adjacent to an HTH protein | 14.29 |
Mean length of the directons containing the candidates | 4.285714285714286 |
Percent of cluster members that occur in self-targeting genomes | 42.86 |
Number of members in the cluster | 7 |
Model score for cluster | 0.5 |
Consensus sequence | MSMNNDTVTAKTYWVWTDKAEEENPQRSREGEPIWPHYLHEAPKRWLDDGLIQDSTEYVK EGQTDLFDFM |
Accessions (where available) / Location |
YP_008129924.1 GAE09605.1 ASSB01000345.1:22817-23029:- LNZF01000005.1:249585-249797:- AUFO01000008.1:25720-25929:- LN909044.1:364676-364882:- AHC22694.1 |