CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-B, CAS-III-B: 1, CAS-I-C: 5, CAS-I-B: 3, CAS-III-B: 3, CAS-II-A: 1 |
---|---|
Percentage of cluster members that co-occur with known Acrs | 16.67 |
Percentage of cluster members that are adjacent to an HTH protein | 83.33 |
Mean length of the directons containing the candidates | 4.166666666666667 |
Percent of cluster members that occur in self-targeting genomes | 66.67 |
Number of members in the cluster | 6 |
Model score for cluster | 0.46 |
Consensus sequence | MSGPSFFQTYMGQRFYETTMPQLVRQLGRLNDNLERLVDVAEQLANQKPASSAETEHPTT TEDSEEP |
Accessions (where available) / Location |
ABF89282.1 AOBT01000042.1:19964-20167:- AKYI02000043.1:46637-46840:- AEI69177.1 AKF80114.1 AGT06960.1 |