Cluster: cluster_1646

CRISPR-Cas subtypes that co-occur with the candidate	CAS-I-C: 29, CAS-II-A: 62
Percentage of cluster members that co-occur with known Acrs	0.0
Percentage of cluster members that are adjacent to an HTH protein	1.61
Mean length of the directons containing the candidates	3.532258064516129
Percent of cluster members that occur in self-targeting genomes	9.68
Number of members in the cluster	62
Model score for cluster	0.22
Consensus sequence	MRPNKYPYSKPQWEKEVSNIYVDNGYTIPYTTLVHYINRLTGEVRV
Accessions (where available) / Location	EPT73242.1 EPV63917.1 EPX38579.1 EPV59490.1 EPW57514.1 EZM37427.1 EZL54694.1 EZM48501.1 EZL95136.1 EZL07026.1 EZL69694.1 EZL31550.1 EZK91580.1 EZM24986.1 EZL57920.1 EZM37985.1 EZL74561.1 EZL13832.1 EZM44465.1 EZK73165.1 EZL07942.1 EZK92229.1 EPW80150.1 EZL28847.1 EZK76185.1 EZL50802.1 EZM00286.1 EZM15632.1 AYPA01000016.1:6034-6174:+ EZL90475.1 EZL91233.1 EZK86098.1 EZL90187.1 EZK58617.1 EZL48205.1 EZM29472.1 EZM55433.1 EZM28882.1 EZM89477.1 EZM04851.1 EZL68290.1 EZN06408.1 ALKE01000025.1:4100-4240:+ ATXR01000018.1:14490-14630:- EZL75498.1 EZM56021.1 EZK55482.1 EZM34589.1 EZL34193.1 EZL97512.1 EZL59242.1 EZL18863.1 AIW25036.1 EZL60708.1 EZL62498.1 EZL81165.1 EPW30667.1 EPX26203.1 KXA53941.1 EPX14671.1 EPW72030.1 EPT95230.1