Cluster: cluster_1776

CRISPR-Cas subtypes that co-occur with the candidate	CAS-I-E: 58
Percentage of cluster members that co-occur with known Acrs	1.85
Percentage of cluster members that are adjacent to an HTH protein	1.72
Mean length of the directons containing the candidates	2.017241379310345
Percent of cluster members that occur in self-targeting genomes	1.85
Number of members in the cluster	58
Model score for cluster	0.19
Consensus sequence	MARSGPTESLACDQTRGGSSGRKKRSPWTPRPLSRREKIPVSGQLTC
Accessions (where available) / Location	EIN88899.1 EHU58310.1 KPP30985.1 KPP14072.1 KXM34495.1 KLH55959.1 KIZ13160.1 KOZ55188.1 AFJ28534.1 BAB35676.1 BAB35392.1 KMM07482.1 AFJ29145.1 AFJ28776.1 KXM88615.1 KKK28517.1 AMG78928.1 KOZ61927.1 KPP47959.1 KOZ25278.1 KRQ15248.1 KML95231.1 ALH90265.1 KNF58612.1 KPP28370.1 BAB35213.1 KOZ05348.1 KXL57300.1 KUS35335.1 KNZ06944.1 KUU32660.1 KNY81113.1 KUT20629.1 AKM77473.1 KNF25300.1 KNY86587.1 KUU22091.1 KLH30445.1 KNG13547.1 KUT65039.1 KUU90906.1 KDV43762.1 KLH77574.1 KLH17791.1 KLH67738.1 KNY71288.1 KLH20927.1 KNG21083.1 KNZ18230.1 KNF17178.1 KDV47584.1 KNG04411.1 KNY67067.1 KLH13988.1 KNY62309.1 KPO52767.1 KNG30014.1 KLG49276.1