CRISPR-Cas subtypes that co-occur with the candidate | CAS-II-C: 3, CAS-III-B: 4, CAS-I-B: 1, CAS-III-D: 1 |
---|---|
Percentage of cluster members that co-occur with known Acrs | 16.67 |
Percentage of cluster members that are adjacent to an HTH protein | 83.33 |
Mean length of the directons containing the candidates | 1.833333333333333 |
Percent of cluster members that occur in self-targeting genomes | 33.33 |
Number of members in the cluster | 6 |
Model score for cluster | 0.15 |
Consensus sequence | MIPLEQCAAILNKGKKKYDNENVKIIRQYLYLLAELQIENEKIESTKKQEL |
Accessions (where available) / Location |
BCAD01000075.1:4308-4463:+ EIY42111.1 JUOZ01000298.1:6611-6766:+ JUOA01000042.1:1517-1672:- EIY53100.1 EIY64834.1 |