CRISPR-Cas subtypes that co-occur with the candidate | CAS-II-C: 2, CAS-I-F: 54, CAS-VI-C: 2 |
---|---|
Percentage of cluster members that co-occur with known Acrs | 1.82 |
Percentage of cluster members that are adjacent to an HTH protein | 5.36 |
Mean length of the directons containing the candidates | 2.946428571428572 |
Percent of cluster members that occur in self-targeting genomes | 9.09 |
Number of members in the cluster | 56 |
Model score for cluster | 0.76 |
Consensus sequence | MTKRKPKKDASITIHMPTDHKEQLSSLAEMLRAGQGASEYVYETLIKPHLQKLKAETKIK QKIFGLTESDKNHELHSDLSVRSETADIKKA |
Accessions (where available) / Location |
BBSQ01000004.1:67651-67929:- AIEL01000062.1:10483-10761:+ KRJ45469.1 KWA87770.1 ETQ56305.1 KRI87575.1 KQD56189.1 KQF04042.1 KQD66732.1 KQF75160.1 ETR03269.1 KQE09741.1 KRJ59348.1 KQD77482.1 ENW35982.1 KRJ90613.1 KQG82418.1 KQF39676.1 KQG67231.1 KQD01014.1 KQG58764.1 KQD85998.1 KRI18653.1 KQE44874.1 KQG89542.1 KQD54046.1 KRJ90334.1 KWA97044.1 KRJ04991.1 KQD65657.1 KQD74129.1 KQD36558.1 KQG50656.1 ETR01563.1 KQG81112.1 KQD81041.1 KQF11427.1 ETR21434.1 KRJ80433.1 KQG65985.1 CAM87576.1 KQG87265.1 KRI58092.1 KQD98105.1 KQD72314.1 KQG43903.1 EKL50711.1 KQG77856.1 KQD47691.1 KQH00518.1 KQG53781.1 KQG68974.1 KQG66531.1 KQD93221.1 KQD44981.1 KQE30298.1 |