Cluster: cluster_187580

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-C: 1
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 100.0
Mean length of the directons containing the candidates 2.0
Percent of cluster members that occur in self-targeting genomes 100.0
Number of members in the cluster 1
Model score for cluster 0.66
Consensus sequence METQMSSRERFAWVFLVLLVVSYGTYFTAVAVLDARGELTFWSQLIMLTASAVFQGVVLG
VSALVGRMRRAPGERTAPDERDRAIAHRSASVAYYVLMGGMVLVGCIMPFGASGWKVANA
AILAIVIAELVHTGLTVSGYRRGLRA
Accessions (where available) / Location AKF86848.1