CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-B: 1, CAS-I-C: 5, CAS-II-C: 1, CAS-III: 1 |
---|---|
Percentage of cluster members that co-occur with known Acrs | 0.0 |
Percentage of cluster members that are adjacent to an HTH protein | 40.0 |
Mean length of the directons containing the candidates | 2.2 |
Percent of cluster members that occur in self-targeting genomes | 20.0 |
Number of members in the cluster | 5 |
Model score for cluster | 0.26 |
Consensus sequence | MENIQNKSALIPSDEIRSEERLAEQKFEAFITSLAHIIEKYGMRVLGEVDGAA |
Accessions (where available) / Location |
ADJS01020407:1695-1856:- EGB92745.1 ENZ49512.1 BBZQ01000057.1:12099-12260:- ENZ45739.1 |