CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-B: 3, CAS-II-C: 3, CAS-III-B: 2, CAS-III-B, CAS-I-B: 2, CAS-I-C: 1 |
---|---|
Percentage of cluster members that co-occur with known Acrs | 0.0 |
Percentage of cluster members that are adjacent to an HTH protein | 20.0 |
Mean length of the directons containing the candidates | 4.4 |
Percent of cluster members that occur in self-targeting genomes | 50.0 |
Number of members in the cluster | 5 |
Model score for cluster | 0.65 |
Consensus sequence | MQIKRISFDELPSFVRDHINARYKDPQPIEATVMEFDTVPPLYAVSVLDLDRNIIAEVTF DDGKGILHENRVTLGTVFEAMKKYPERFGLELRE |
Accessions (where available) / Location |
KFZ41918.1 KFX35873.1 KFX31330.1 JYCF01000138.1:2999-3274:+ AMRO01000024.1:35991-36266:+ |