CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-F: 2, CAS-I-C: 4, CAS-III-D: 2, CAS-III-A: 2 |
---|---|
Percentage of cluster members that co-occur with known Acrs | 0.0 |
Percentage of cluster members that are adjacent to an HTH protein | 20.0 |
Mean length of the directons containing the candidates | 2.2 |
Percent of cluster members that occur in self-targeting genomes | 75.0 |
Number of members in the cluster | 5 |
Model score for cluster | 0.49 |
Consensus sequence | TELKQEKASLGQELAVLVEMLENCIAENARIAQDQGEYQKRYNGLVERYEEAKGWFDEVT EAIAERSAKAERLAGFIKTFEGQNGPQWKFDEELWGGML |
Accessions (where available) / Location |
EEX68002.1 JHXC01000015.1:24431-24763:+ JHXC01000015.1:28028-28321:+ CCC73863.1 EGK59000.1 |