CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-E: 4, CAS-II-C: 1, CAS-I-F: 1 |
---|---|
Percentage of cluster members that co-occur with known Acrs | 20.0 |
Percentage of cluster members that are adjacent to an HTH protein | 20.0 |
Mean length of the directons containing the candidates | 2.6 |
Percent of cluster members that occur in self-targeting genomes | 60.0 |
Number of members in the cluster | 5 |
Model score for cluster | 0.48 |
Consensus sequence | MKQVDDSKRFPPLNGKSPEEIIEHFKSYNFVDDHGHRLDLCQDFLDLVELASRA |
Accessions (where available) / Location |
KII04375.1 EOW21288.1 EWD82921.1 EOC14815.1 ETS31074.1 |