| CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-E: 1, CAS-I-F: 51 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 0.0 |
| Percentage of cluster members that are adjacent to an HTH protein | 1.92 |
| Mean length of the directons containing the candidates | 2.0 |
| Percent of cluster members that occur in self-targeting genomes | 98.08 |
| Number of members in the cluster | 52 |
| Model score for cluster | 0.22 |
| Consensus sequence | MTIDGIRGYISCTPAKSGVGICTLDITTTHSRVCGFFMRNV |
| Accessions (where available) / Location |
KDV66904.1 EIR47316.1 EIT14597.1 EIQ89921.1 EIS79164.1 EIS75085.1 EIS67198.1 EIR76706.1 EIR20484.1 EIR02011.1 EIS56518.1 EIS04593.1 EIS91494.1 EIR60245.1 EIS06210.1 EIS18112.1 EIR03636.1 EIR61054.1 EIR46276.1 AAM85779.1 EDR43998.1 EIS18708.1 EDR37590.1 EIS25376.1 EFA50084.1 EIS43625.1 EIT30218.1 EIR17543.1 EIR18474.1 EIQ90770.1 EIR34103.1 EIR33747.1 EIS32158.1 EDR57814.1 EIS42463.1 EIS57079.1 EIS29418.1 EIT16568.1 EIS95663.1 EIQ88345.1 EIS99059.1 EIT46370.1 EIT45786.1 EIR74402.1 EIR88469.1 EIR90898.1 EIS45288.1 EIR49247.1 EIR31988.1 EIT27052.1 EIT63086.1 EIS87481.1 |