CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-E: 5, CAS-I-B: 1, CAS-III-B, CAS-III-D: 1, CAS-I-C: 1, CAS-I-U: 1, CAS-III-D, CAS-I-B: 1 |
---|---|
Percentage of cluster members that co-occur with known Acrs | 0.0 |
Percentage of cluster members that are adjacent to an HTH protein | 20.0 |
Mean length of the directons containing the candidates | 3.4 |
Percent of cluster members that occur in self-targeting genomes | 25.0 |
Number of members in the cluster | 5 |
Model score for cluster | 0.54 |
Consensus sequence | VTDRPPYPNVDLQEVRTRNLTAREIISTFAEAMPTLADLWLHIYDALADTPVLVAEISRL RAELVRVRHQRANLVAAGRATLHAHRDGEPDPLYYLRDELRAQGHLPPDERGRR |
Accessions (where available) / Location |
KL574442.1:10237-10587:- BCQS01000014.1:7201-7545:+ BCQR01000163.1:18232-18576:- KB907211.1:61761-62090:- KL574407.1:280793-281140:+ |