CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-B: 4 |
---|---|
Percentage of cluster members that co-occur with known Acrs | 0.0 |
Percentage of cluster members that are adjacent to an HTH protein | 100.0 |
Mean length of the directons containing the candidates | 4.8 |
Percent of cluster members that occur in self-targeting genomes | 20.0 |
Number of members in the cluster | 5 |
Model score for cluster | 0.44 |
Consensus sequence | MAQKCDQKAKKRHRNVTKKINLKSYNIEKEKYEREKNRINIFRRFR |
Accessions (where available) / Location |
YP_009221780.1 CCL66975.1 CCL51133.1 CCL12288.1 CCL55103.1 |