Cluster: cluster_2172

CRISPR-Cas subtypes that co-occur with the candidate	CAS-I-C: 26, CAS-I-B: 21, CAS-III-A: 4, CAS-III-D: 5, CAS-VI-A: 2, CAS-III: 1, CAS-II-C: 5, CAS-II-A: 2, CAS-I-B, CAS-III: 1
Percentage of cluster members that co-occur with known Acrs	0.0
Percentage of cluster members that are adjacent to an HTH protein	2.04
Mean length of the directons containing the candidates	2.6326530612244903
Percent of cluster members that occur in self-targeting genomes	17.39
Number of members in the cluster	49
Model score for cluster	0.41
Consensus sequence	MMMNKVYVDVVAEFSKDGELIPLFIVWEDGRKYEIDRVLDVRRAASLKAGGVGIRYTCMI SGKEVYLFYEENKWFMERK
Accessions (where available) / Location	AUJA01000005.1:68048-68467:- AUJV01000006.1:211239-211658:+ EDO57723.1 ESL02423.1 EFE13784.1 KQC86343.1 EEC58723.1 LARF01000089.1:920-1174:+ EEA83463.1 CRL42358.1 EEG95993.1 CRL43373.1 LN868537.1:678219-678476:+ DF158897.1:291967-292251:+ CDD41591.1 KJF38457.1 EEG37684.1 CCK87135.1 ENZ58219.1 CRL39914.1 AUJS01000017.1:62240-62479:+ BBZQ01000066.1:13188-13427:- ETD19468.1 CCK94234.1 BBZT01000007.1:43689-43928:+ EHO84763.1 EFH07422.1 ADJS01020332:2005-2244:- AUJF01000103.1:2094-2333:- AKCD01000002.1:181044-181283:- EQB27439.1 EQB25622.1 CQR73285.1 CQR74179.1 AUIL01000056.1:5945-6199:+ JMLZ01000001.1:306489-306728:+ EAX47888.1 ALU14590.1 EIW20700.1 EIW32790.1 EIW25455.1 AMZI01000138.1:5288-5527:- EMS71901.1 EGD48451.1 BBAA01000030.1:44452-44685:+ ACL76355.1 JAGE01000001.1:152505-152738:+ JHYD01000009.1:213152-213385:+ EEF66481.1