| CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-F: 47 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 4.76 |
| Percentage of cluster members that are adjacent to an HTH protein | 6.38 |
| Mean length of the directons containing the candidates | 3.404255319148936 |
| Percent of cluster members that occur in self-targeting genomes | 14.29 |
| Number of members in the cluster | 47 |
| Model score for cluster | 0.2 |
| Consensus sequence | MITNDFAKGDVVALQGAWTDLMTVEKVEYGKVYFTSGDYADLSKVRHAEPEEIEAGCKLY |
| Accessions (where available) / Location |
KQH02265.1 KQF08231.1 KQG71580.1 KQD65023.1 AIS05566.1 KQD71173.1 KQG79125.1 KQE02463.1 ASES01000037.1:13788-13970:- KQG63399.1 KQG39709.1 AMHC01000045.1:2700-2882:+ KRI17473.1 KQG91188.1 KQG53934.1 ASET01000100.1:17820-18002:- KQF80857.1 KQD68107.1 KQC99944.1 LAIY01000024.1:82357-82539:+ KRJ89021.1 KQD52362.1 KQG56153.1 KQG73092.1 KRJ83712.1 KRJ25831.1 KQG39418.1 ETR03612.1 KQD44881.1 KQF04138.1 KQG68312.1 KQD61642.1 KRJ78304.1 KQD42074.1 KQG41430.1 KQG87392.1 KQD64922.1 KQD51126.1 KQD89210.1 KQD80146.1 KKZ44911.1 KQG46256.1 KQD90385.1 KQE37280.1 KQG89367.1 KQE13085.1 KQG62662.1 |