CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-B: 1, CAS-I-C: 1, CAS-I-E: 1 |
---|---|
Percentage of cluster members that co-occur with known Acrs | 0.0 |
Percentage of cluster members that are adjacent to an HTH protein | 100.0 |
Mean length of the directons containing the candidates | 2.0 |
Percent of cluster members that occur in self-targeting genomes | 100.0 |
Number of members in the cluster | 1 |
Model score for cluster | 0.49 |
Consensus sequence | MSKLPQSRAARRFGLFLAAVLVLYAAVTYPARSAEFTALMFAAVADATEGVGELVTDPLP |
Accessions (where available) / Location |
JOEK01000001.1:338886-339068:+ |