| CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-F: 5, CAS-I-E: 37 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 0.0 |
| Percentage of cluster members that are adjacent to an HTH protein | 4.65 |
| Mean length of the directons containing the candidates | 2.627906976744186 |
| Percent of cluster members that occur in self-targeting genomes | 6.98 |
| Number of members in the cluster | 43 |
| Model score for cluster | 0.29 |
| Consensus sequence | MEQTGRLFKQRRLSTTWLKSQITQPHKLWDAMPKQPSQEELRDCIAKVYSGGIYVQKNRI |
| Accessions (where available) / Location |
EQN21119.1 EQQ42212.1 KPH29098.1 KPP55116.1 KPP50293.1 KSZ18751.1 KOZ89346.1 KPH40434.1 ABE06767.1 KOZ04834.1 KXL20647.1 KOZ06104.1 KOZ37512.1 KNY59788.1 KOZ43303.1 KPP24594.1 KPP33774.1 BAB34605.1 KOZ03128.1 KQI84384.1 KOZ33984.1 KNG07993.1 KJW69682.1 KDV35927.1 ALL90831.1 KOZ19294.1 KPP09964.1 KKF84298.1 KXR77573.1 KNF76133.1 KOZ49725.1 CRL91226.1 KOZ35870.1 KPP45097.1 KNY69597.1 KNF12478.1 YP_002274158.1 KJW64669.1 KKY47310.1 KLH23510.1 AMG77762.1 KXR54512.1 KPO77219.1 |