Cluster: cluster_2474

CRISPR-Cas subtypes that co-occur with the candidate CAS-II-C: 43
Percentage of cluster members that co-occur with known Acrs 97.67
Percentage of cluster members that are adjacent to an HTH protein 20.93
Mean length of the directons containing the candidates 4.558139534883721
Percent of cluster members that occur in self-targeting genomes 95.35
Number of members in the cluster 43
Model score for cluster 0.73
Consensus sequence MSKKSLIALMTAAMQPDFSHSDLGIRYAMPTQGCWTQAHRKSGVAAAKRAAKKKRHK
Accessions (where available) / Location EOC70735.1
ELK76484.1
EOB84996.1
EOB90951.1
EOB67507.1
EOB48832.1
EJU55079.1
ELL09884.1
ELL03364.1
JVYR01000022.1:25187-25360:-
ELL22004.1
EJU53174.1
EOB87683.1
ELK72570.1
CAX50200.1
ELK65700.1
ELL32409.1
ELL27111.1
ELL09063.1
ELL15361.1
EOB93689.1
ELK72757.1
EOB48909.1
EOB80957.1
ELK78311.1
ELL08563.1
EOB54651.1
EPF55608.1
EOC53324.1
EOB68248.1
EOB54391.1
EOB74839.1
ELL20115.1
EOC15359.1
EOB72580.1
EOC51933.1
ELL22829.1
ELK66115.1
EOB86640.1
EOB74321.1
EOB80708.1
EOB60428.1
EOB78738.1