| CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-E: 22, CAS-I-F: 21 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 7.14 |
| Percentage of cluster members that are adjacent to an HTH protein | 4.65 |
| Mean length of the directons containing the candidates | 2.651162790697674 |
| Percent of cluster members that occur in self-targeting genomes | 7.14 |
| Number of members in the cluster | 43 |
| Model score for cluster | 0.21 |
| Consensus sequence | MEGNSLKNIDELSGCISRQWAGNGTPITSLPIENGVSLLVPQAMGGYDVVLDIKKAGNGS SFTLYERVPALTPKIFADSVNACK |
| Accessions (where available) / Location |
KEN88034.1 EQZ58679.1 EQO24696.1 ENE83334.1 EHF64902.1 EQR49259.1 EQN20425.1 ELF13112.1 ELE24343.1 EHF30598.1 KEL74701.1 EQQ41620.1 ENE91036.1 EQU72234.1 CRL90810.1 ELG33280.1 EOU35103.1 EQV15918.1 EDX27615.1 KEJ79089.1 EQO63094.1 ELC01910.1 ELG29829.1 EQT82152.1 EOX15238.1 EHX42308.1 EQW21108.1 EHX30693.1 EQN70827.1 EQZ54974.1 KXG68427.1 EOV65586.1 ELC10611.1 EQV06986.1 ELJ46073.1 EQO66374.1 EKZ90058.1 EGB59218.1 EHF32381.1 EQW92972.1 EQP25260.1 EKZ88924.1 JHTM01000244.1:66-257:- |