| CRISPR-Cas subtypes that co-occur with the candidate | CAS-II-A: 29, CAS-I-B: 23 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 57.89 |
| Percentage of cluster members that are adjacent to an HTH protein | 14.63 |
| Mean length of the directons containing the candidates | 3.902439024390244 |
| Percent of cluster members that occur in self-targeting genomes | 44.74 |
| Number of members in the cluster | 41 |
| Model score for cluster | 0.8 |
| Consensus sequence | MNIRYLSNKRSEEKDLVFKTKNIPPENLKSLNIEMQGDRNCCYGVLEINGKQLGKGITAV KLDLKAGSLPVVQVEYHPFTISEEMRRLLWSGKY |
| Accessions (where available) / Location |
KET99761.1 KHK14246.1 AEO07302.1 KHK08359.1 CDM20177.1 KEV03547.1 AGR27333.1 KHK33719.1 AEO04740.1 AEO04418.1 EHN62244.1 CWLB01000053.1:6879-7163:- CWMG01000027.1:1727-2011:+ YP_009210487.1 AGR09813.1 CWMY01000291.1:2710-2994:+ KEX57664.1 EFG00351.1 EFG00236.1 CWKV01000004.1:4591-4875:+ CWMO01000430.1:682-966:- CWMX01000222.1:7406-7690:- CWKQ01000006.1:4488-4772:+ CUL84432.1 KTA29680.1 CUL45457.1 KHK04866.1 KHK19819.1 KES84853.1 AKI44640.1 CUK86096.1 CUM22278.1 EEW20566.1 EFR92345.1 EFG02107.1 CUL35419.1 AEH93704.1 CWMX01000162.1:961-1242:+ AKS55206.1 CAR85356.1 ACK41278.1 |