| CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-B: 41 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 0.0 |
| Percentage of cluster members that are adjacent to an HTH protein | 4.88 |
| Mean length of the directons containing the candidates | 2.9268292682926838 |
| Percent of cluster members that occur in self-targeting genomes | 17.07 |
| Number of members in the cluster | 41 |
| Model score for cluster | 0.28 |
| Consensus sequence | MSRIVLTFKNNDKEKAIEKFLDEKLSATAYLKELVWEKMNEKKDNAVVEQKKEIEDPANN FDFGSLE |
| Accessions (where available) / Location |
CEP39588.1 CEP79248.1 EQF90159.1 AKP44631.1 EQE75268.1 CCL16235.1 EQI87057.1 EQJ24440.1 EQH66148.1 EQK17098.1 EQI60822.1 EQH89377.1 KPI46365.1 EQF05447.1 AQWV01000027.1:3322-3525:- EQG12948.1 EQH49287.1 EQG39899.1 ABHD02000052.1:4588-4791:+ EQH42433.1 EQE94645.1 FN668944.1:4116128-4116331:+ EQI06761.1 EQI22489.1 EQE80203.1 EQJ74542.1 EQE55826.1 EQF46836.1 AUOX01000028.1:39336-39539:+ ABHF02000060.1:4588-4791:+ FN668942.1:22496-22699:- EQG96019.1 CCL24683.1 EQL05021.1 CM000661.1:436258-436461:- EQJ06565.1 ABHG02000042.1:4823-5026:- EQF42507.1 EQJ02601.1 EQG46198.1 EQE72049.1 |