| CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-F: 21, CAS-I-E: 11, CAS-I-C: 4, CAS-IV-A: 3 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 58.33 |
| Percentage of cluster members that are adjacent to an HTH protein | 2.56 |
| Mean length of the directons containing the candidates | 4.769230769230768 |
| Percent of cluster members that occur in self-targeting genomes | 58.33 |
| Number of members in the cluster | 39 |
| Model score for cluster | 0.52 |
| Consensus sequence | MHTLNLTALFLDGEDGQRLAEVNGLPRLGALLSSSQLRQLARQLNEIANDADQGASGEHC YTAPPYGACPPCHSTKAPQSAA |
| Accessions (where available) / Location |
CUYB01000031.1:272003-272290:- JTWH01000040.1:10080-10367:+ JTYY01000002.1:327981-328268:- JTRZ01000033.1:8882-9169:+ JTMV01000039.1:50014-50301:+ JUAR01000005.1:10738-11025:+ JTPV01000093.1:6209-6496:- EAZ59676.1 JTRN01000003.1:8879-9166:+ JTYP01000006.1:432227-432514:- JTPE01000005.1:92240-92527:+ EZN92278.1 KSD58659.1 KRU77778.1 EQM84006.1 ERY58736.1 KQJ58208.1 AHC75465.1 EZO00761.1 KSQ09331.1 KSQ20151.1 KSG80704.1 KSS38216.1 KGB87376.1 EZO00874.1 JTSL01000044.1:101563-101811:- KWR92729.1 ERY85876.1 KSL15361.1 YP_005098031.1 KSE58628.1 EZN54535.1 KSE10139.1 KQJ68638.1 YP_009275639.1 KSR57038.1 YP_009289268.1 KPA96004.1 KSE58740.1 |