| CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-D: 28, CAS-III-B: 29, CAS-III-D: 13, CAS-I-B: 12, CAS-III-A: 3, CAS-III-B, CAS-I-D: 1, CAS-I-A, CAS-III-A: 1, CAS-I-C: 2, CAS-III-C: 3, CAS-I-U: 2, CAS-III-D, CAS-I-A: 1, CAS-I-E: 2 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 0.0 |
| Percentage of cluster members that are adjacent to an HTH protein | 5.13 |
| Mean length of the directons containing the candidates | 4.102564102564102 |
| Percent of cluster members that occur in self-targeting genomes | 20.51 |
| Number of members in the cluster | 39 |
| Model score for cluster | 0.25 |
| Consensus sequence | MFYYSESIIATISNVMSEKKSSYNTNVNLNDVQEPITNAPPEVRQIIERVLQAEKDKLYM KNPRNINDDILKIIKEVVQ |
| Accessions (where available) / Location |
KEI68640.1 AFZ21879.1 CBN54442.1 KB235904.1:1137940-1138185:- KKD37351.1 EAW34596.1 ERT05503.1 LAYT01000228.1:12455-12697:- KE734717.1:920628-920867:- KE734727.1:193960-194199:+ KE734694.1:599757-599996:- KE734720.1:2784815-2785054:+ AVFT01000013.1:39210-39449:- KE734706.1:210909-211148:- KE734710.1:209432-209671:- KE734738.1:5229799-5230038:+ KJH73129.1 AFY79463.1 ALVU02000001.1:3064245-3064418:+ KB235949.1:615409-615582:+ AFY84801.1 AFZ09860.1 EGK88204.1 KOR37531.1 KL662191.1:4411803-4411976:- JH992901.1:1878360-1878533:- AFZ30480.1 ABA21820.1 BAU13924.1 AFZ60192.1 KB235896.1:5111953-5112126:- AFW94730.1 AFY48436.1 JH976537.1:2050197-2050367:- KIF15853.1 KIF40777.1 ELS32752.1 LIRE01000750.1:9867-10040:- JH980292.1:2029256-2029429:- |