CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-E: 34, CAS-I-F: 2 |
---|---|
Percentage of cluster members that co-occur with known Acrs | 0.0 |
Percentage of cluster members that are adjacent to an HTH protein | 2.7 |
Mean length of the directons containing the candidates | 4.45945945945946 |
Percent of cluster members that occur in self-targeting genomes | 0.0 |
Number of members in the cluster | 37 |
Model score for cluster | 0.31 |
Consensus sequence | MSQKTANHENRVRECNDILDTHLKDMQTGFMIRTNSGEFMIRDKKLIKKITKDVACHVDG ELLKLGM |
Accessions (where available) / Location |
KNK12523.1 KNH84032.1 KNU21213.1 KNT64305.1 KNX20721.1 KNM44432.1 EXF38548.1 ARYW01000006.1:109300-109503:- KNW89258.1 ESK19210.1 KNL66893.1 EGB75987.1 KDT59421.1 KUE15303.1 KNN08126.1 KNS24319.1 KNV93568.1 KUH09670.1 KUB35442.1 AIT45542.1 KMK31202.1 KXP96122.1 KUE07168.1 KPO17857.1 YP_009191781.1 KTX55464.1 KUB21678.1 KOK43070.1 KUT57250.1 EOW27302.1 KJV17207.1 YP_009218852.1 JSML01000043.1:10658-10861:+ KNP29320.1 EQY53564.1 JHRS01000065.1:9190-9297:- JHTM01000075.1:21218-21325:- |