CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-C: 33, CAS-I-F: 3, CAS-III-A: 1, CAS-II-C: 1 |
---|---|
Percentage of cluster members that co-occur with known Acrs | 0.0 |
Percentage of cluster members that are adjacent to an HTH protein | 2.7 |
Mean length of the directons containing the candidates | 2.621621621621621 |
Percent of cluster members that occur in self-targeting genomes | 60.0 |
Number of members in the cluster | 37 |
Model score for cluster | 0.5 |
Consensus sequence | MLFKEKGYDEFLAEKIRKGQEELAAGKGFTLEQSRNEIQHTIEQKSQELNEFENEVNYG |
Accessions (where available) / Location |
AGQ25424.1 AGR75897.1 KIX31799.1 EPZ29365.1 AGI31807.1 EPZ29653.1 AGQ40981.1 AGK00556.1 EME02497.1 EPZ30452.1 EPZ03615.1 AKA10640.1 AGQ38456.1 AKA13246.1 EDN75600.1 AFI87989.1 EEY10967.1 EEY12926.1 AJE08856.1 AGR74890.1 EPZ28869.1 EPZ26509.1 EPZ03084.1 YP_009207768.1 AGK02315.1 YP_655484.1 AGI32566.1 AGQ40207.1 AGQ24852.1 AGI35449.1 AEC16355.1 KB903676.1:15024-15197:- AGR74679.1 AGI34901.1 EME04735.1 AGK01951.1 AHG73264.1 |