| CRISPR-Cas subtypes that co-occur with the candidate | CAS-II-C: 33, CAS-VI-B: 7, CAS-III-A: 2 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 0.0 |
| Percentage of cluster members that are adjacent to an HTH protein | 54.29 |
| Mean length of the directons containing the candidates | 4.371428571428571 |
| Percent of cluster members that occur in self-targeting genomes | 2.86 |
| Number of members in the cluster | 35 |
| Model score for cluster | 0.17 |
| Consensus sequence | MRLSNRNKTPYYNFINTLLIMMLVIGIIAFILEEYRFNILGPESYLLIIIPILLLIIFYL NGRQIFEYDSDGEALNFRNRNIIPFLSKPLSDEFPKYKLLKYEIVDIFFFKRLYITISSK NNGSTILKYDISYLTRKEVNDLKLSLNKVVKANKEKKNNR |
| Accessions (where available) / Location |
GAE64505.1 KPH14614.1 EJL71827.1 KQM20526.1 BACY01000147.1:9262-9744:+ KFF12397.1 KN549101.1:421604-422086:- KFF00852.1 LAZY01000054.1:23489-23965:+ KN549082.1:28288-28764:+ KFF24288.1 KFF21707.1 KMQ64853.1 KMQ68997.1 AKK74508.1 KQK25534.1 KUJ56861.1 KNB60587.1 KN549096.1:1518224-1518673:- KN549100.1:12484-12921:- JQKZ01000009.1:62475-62903:+ JQMA01000011.1:62548-62976:+ KQS92826.1 KE384528.1:52947-53447:- AUAA01000059.1:6544-7044:- ADZ13106.1 AFR36448.1 LAVB01000007.1:56149-56643:- EFT35901.1 AGC40706.1 AKQ38955.1 AKP68679.1 EKB55464.1 EKB58492.1 AULL01000019.1:3069-3482:+ |