Cluster: cluster_3165

CRISPR-Cas subtypes that co-occur with the candidate CAS-I-B: 22, CAS-III-B: 8, CAS-I-D: 1, CAS-III-B, CAS-I-B: 2, CAS-I-B, CAS-III-B: 1, CAS-III-D: 1, CAS-III-A: 1
Percentage of cluster members that co-occur with known Acrs 0.0
Percentage of cluster members that are adjacent to an HTH protein 24.24
Mean length of the directons containing the candidates 2.787878787878788
Percent of cluster members that occur in self-targeting genomes 18.18
Number of members in the cluster 33
Model score for cluster 0.5
Consensus sequence MEDIKVTVTQEKREETIDKILELVEEEFKGIDVTAVFTKRLLEDTIRTLENRCMETSLRF
INKGVNEGH
Accessions (where available) / Location KEH91639.1
CAL83933.1
BBDS01000003.1:12281-12523:-
JUYE01000169.1:4120-4359:+
LAGM01000216.1:12077-12316:-
LFPK01000030.1:992404-992643:-
LAGD01000193.1:12072-12311:-
KEI16866.1
ACQ53290.1
LFQF01000005.1:125173-125382:+
AZQW01000001.1:42885-43094:-
LFON01000023.1:8370-8576:-
AJE10085.1
BAQ36512.1
KOR24149.1
AJD32111.1
LFOX01000002.1:102730-102987:-
LFPI01000005.1:37201-37458:-
LFOY01000005.1:37179-37436:-
LFOZ01000010.1:58574-58831:+
LFPN01000008.1:862552-862761:-
LFPX01000066.1:888156-888365:-
LFQZ01000006.1:171487-171696:+
LFPQ01000003.1:171487-171696:+
LFPY01000001.1:171487-171696:+
LAGO01000506.1:11084-11293:-
AJD25837.1
AZRQ01000048.1:14736-14945:+
LFQD01000013.1:39381-39590:-
LFPR01000003.1:605317-605526:-
AZRS01000162.1:7202-7411:+
LFPW01000016.1:888368-888577:-
CCAT010000012.1:3214-3405:-