| CRISPR-Cas subtypes that co-occur with the candidate | CAS-II-A: 29, CAS-I-C: 18, CAS-II-C: 1 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 0.0 |
| Percentage of cluster members that are adjacent to an HTH protein | 3.12 |
| Mean length of the directons containing the candidates | 3.03125 |
| Percent of cluster members that occur in self-targeting genomes | 23.33 |
| Number of members in the cluster | 32 |
| Model score for cluster | 0.38 |
| Consensus sequence | MKIKLFYQKHKQSLEEFENQVNDFMAGVEVVDVKYTEATSGDYEAMGTTLGLLVLYK |
| Accessions (where available) / Location |
CECS01000032.1:28237-28500:+ CECU01000007.1:2622-2816:- ALLJ01000019.1:103051-103224:- EEF64808.1 ALLI01000040.1:27297-27470:- ALNC01000001.1:3015-3188:+ ALLI01000026.1:11260-11433:+ CEGV01000023.1:1919-2092:- CEDR01000001.1:81920-82093:- EEF63611.1 JWGG01000030.1:10549-10737:- JWGF01000101.1:37394-37582:- KXT66829.1 EPW65338.1 EPW57309.1 EPW47673.1 EPT74095.1 EPX27765.1 EPV01115.1 EPV54817.1 EPV40412.1 KXA49252.1 EPU85910.1 ANQG01000013.1:68568-68741:+ EQA92873.1 EPV23286.1 CDCQ01000011.1:38118-38291:+ KXA57423.1 EPW01752.1 EPV95851.1 CDCO01000017.1:22534-22707:+ CDCR01000003.1:48672-48845:+ |