| CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-U: 18, CAS-I-C: 6, CAS-I-E: 20, CAS-III-D, CAS-I-B: 2, CAS-IV-A: 1, CAS-I-B: 1, CAS-I-B, CAS-III-D: 1 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 0.0 |
| Percentage of cluster members that are adjacent to an HTH protein | 74.19 |
| Mean length of the directons containing the candidates | 4.709677419354839 |
| Percent of cluster members that occur in self-targeting genomes | 28.57 |
| Number of members in the cluster | 31 |
| Model score for cluster | 0.15 |
| Consensus sequence | MSPTPEARLRRRSRPRPARRAGRVAAALAVAALLVAVPAAAYAAPPDPVVLAANDLPQVI NNIRNWLMGILAAIATLFLTIGGVRYLVAGGDPGEVEKAKDALRNAGIGYGLAVLAPVLV QVIKGIVGG |
| Accessions (where available) / Location |
AZWU01000041.1:19969-20415:- KB913036.1:1989634-1990080:- AZWC01000029.1:15893-16339:- KB904924.1:86785-87231:+ KB895040.1:100714-101160:+ KB896639.1:19906-20352:- KB913022.1:3397184-3397630:- AZVZ01000060.1:8695-8994:+ KB896488.1:30517-30816:+ KB898406.1:93198-93494:- ABW11975.1 KFB05879.1 ABD11066.1 KPM57004.1 ETA00920.1 ABW12167.1 ACU72949.1 JOES01000053.1:5051-5461:+ JOBV01000049.1:5197-5607:+ JOEU01000011.1:41912-42304:+ KUL31414.1 KB896550.1:13636-14016:+ KB896623.1:79831-80211:+ AZWO01000037.1:44771-45151:- KB892550.1:35284-35664:- KI911514.1:109931-110311:- KB892474.1:146163-146537:- KB900157.1:33051-33425:+ KB905223.1:45673-46047:- KB913036.1:5291711-5292085:+ BCQU01000041.1:51149-51490:- |