| CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-C: 31 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 0.0 |
| Percentage of cluster members that are adjacent to an HTH protein | 3.23 |
| Mean length of the directons containing the candidates | 4.387096774193549 |
| Percent of cluster members that occur in self-targeting genomes | 28.0 |
| Number of members in the cluster | 31 |
| Model score for cluster | 0.19 |
| Consensus sequence | MTNSRIRTLAPGVDVERIAVESHFFYDPLTGVANVVFQGMEFLLLDGAVNKMLDGREPLT TTSDAIATRTFAAGLVDPVTGQDLSNVSAAGVVVYLKAVYDRLHNEAAAVQPPAAA |
| Accessions (where available) / Location |
KTF40707.1 CEL40758.1 AJZ52583.1 AJZ65378.1 AJZ47964.1 AJZ43347.1 AGI06953.1 CEE43636.1 CEE59616.1 CEI00035.1 CEG15042.1 CEE80972.1 AJZ51181.1 CEE27686.1 AGI10281.1 AJZ68592.1 AJZ46561.1 CEE57319.1 CEL45326.1 CEE79193.1 CEI19065.1 AJZ55802.1 AAM37505.1 KGR50952.1 KGP58743.1 CCF68700.1 CEH39847.1 KGR64839.1 KGR52979.1 KGT83422.1 CM002139.1:4487452-4487652:+ |