CRISPR-Cas subtypes that co-occur with the candidate | None (candidate detected solely in phages) |
---|---|
Percentage of cluster members that co-occur with known Acrs | 0.0 |
Percentage of cluster members that are adjacent to an HTH protein | 100.0 |
Mean length of the directons containing the candidates | 5.0 |
Percent of cluster members that occur in self-targeting genomes | 0.0 |
Number of members in the cluster | 3 |
Model score for cluster | 0.59 |
Consensus sequence | MINALKLYVAVALVCAVSLQSAATDKADAPYTFMLSMMWPVVLLSALGGETPHE |
Accessions (where available) / Location |
YP_007675289.1 YP_007675441.1 YP_009146243.1 |