| CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-B: 29 |
|---|---|
| Percentage of cluster members that co-occur with known Acrs | 0.0 |
| Percentage of cluster members that are adjacent to an HTH protein | 100.0 |
| Mean length of the directons containing the candidates | 2.5 |
| Percent of cluster members that occur in self-targeting genomes | 33.33 |
| Number of members in the cluster | 30 |
| Model score for cluster | 0.28 |
| Consensus sequence | MKEKKIELIYLEDLDESEKTGVHKNRYQILNEEYEQMIDTYTEMSKRSSYDIVNERHKED FKDELWDYDDTDYDDGLQGKEV |
| Accessions (where available) / Location |
YP_009221781.1 EQL04412.1 EQF64805.1 EQE50993.1 EQF42468.1 EQG33563.1 AKP44851.1 CCL51134.1 EQE22693.1 EQF16054.1 CCL12289.1 EQJ49147.1 EQH92752.1 AQWV01000058.1:66593-66841:+ EQJ51280.1 EQJ88691.1 CCL55102.1 EQL11870.1 AUOX01000031.1:10507-10755:+ EQF50127.1 EQH87518.1 CCL66974.1 EQI89686.1 EQE71591.1 ABHD02000059.1:12179-12427:+ EQF07436.1 EQF21901.1 EQE95413.1 EQJ06185.1 EQF57091.1 |