CRISPR-Cas subtypes that co-occur with the candidate | CAS-I-A: 2, CAS-III-B, CAS-III: 2, CAS-III-D, CAS-I-A: 3, CAS-III-A: 1, CAS-III-B: 1 |
---|---|
Percentage of cluster members that co-occur with known Acrs | 0.0 |
Percentage of cluster members that are adjacent to an HTH protein | 33.33 |
Mean length of the directons containing the candidates | 4.0 |
Percent of cluster members that occur in self-targeting genomes | 50.0 |
Number of members in the cluster | 3 |
Model score for cluster | 0.44 |
Consensus sequence | MKMASLNSLKQIKKPSCPFGRHCFTDSSICGHIGYYAECPPRLDDKIHAEIKEGGYEGED PYDLFRAVRHG |
Accessions (where available) / Location |
BAB65972.1 BAB65288.1 ACP35560.1 |